OLFML2A Antibody

Name OLFML2A Antibody
Supplier Novus Biologicals
Catalog NBP1-56749
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OLFML2A(olfactomedin-like 2A) The peptide sequence was selected from the N terminal of OLFML2A. Peptide sequence EDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OLFML2A
Conjugate Unconjugated
Supplier Page Shop

Product images