CCDC60 Antibody

Name CCDC60 Antibody
Supplier Novus Biologicals
Catalog NBP1-56747
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CCDC60(coiled-coil domain containing 60) The peptide sequence was selected from the C terminal of CCDC60. Peptide sequence RPAKKILVKLQKFGENLDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CCDC60
Conjugate Unconjugated
Supplier Page Shop

Product images