ZCCHC14 Antibody

Name ZCCHC14 Antibody
Supplier Novus Biologicals
Catalog NBP1-56777
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZCCHC14(zinc finger, CCHC domain containing 14) The peptide sequence was selected from the N terminal of ZCCHC14. Peptide sequence RYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGTVMGVSG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZCCHC14
Conjugate Unconjugated
Supplier Page Shop

Product images