R3HDM2 Antibody

Name R3HDM2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56775
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to R3HDM2(R3H domain containing 2) The peptide sequence was selected from the middle region of R3HDM2 (NP_055740). Peptide sequence QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene R3HDM2
Conjugate Unconjugated
Supplier Page Shop

Product images