CELA1 Antibody

Name CELA1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56694
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to ELA1(elastase 1, pancreatic) The peptide sequence was selected from the N terminal of ELA1. Peptide sequence LVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGT.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CELA1
Supplier Page Shop

Product images