Cytohesin 4 Antibody

Name Cytohesin 4 Antibody
Supplier Novus Biologicals
Catalog NBP1-56913
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PSCD4(pleckstrin homology, Sec7 and coiled-coil domains 4) The peptide sequence was selected from the N terminal of PSCD4. Peptide sequence NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CYTH4
Conjugate Unconjugated
Supplier Page Shop

Product images