Name | RIC8B Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56878 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to RIC8B(resistance to inhibitors of cholinesterase 8 homolog B (C. elegans)) The peptide sequence was selected from the middle region of RIC8B. Peptide sequence KETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPV |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | RIC8B |
Conjugate | Unconjugated |
Supplier Page | Shop |