RIC8B Antibody

Name RIC8B Antibody
Supplier Novus Biologicals
Catalog NBP1-56877
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RIC8B(resistance to inhibitors of cholinesterase 8 homolog B (C. elegans)) The peptide sequence was selected from the middle region of RIC8B. Peptide sequence HQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLD
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RIC8B
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.