TASP1 Antibody

Name TASP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56869
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TASP1(taspase, threonine aspartase, 1) The peptide sequence was selected from the middle region of TASP1. Peptide sequence QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TASP1
Conjugate Unconjugated
Supplier Page Shop

Product images