MIER2 Antibody

Name MIER2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56868
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MIER2(mesoderm induction early response 1, family member 2) The peptide sequence was selected from the middle region of MIER2. Peptide sequence RLRFNVKVIRDGLCAWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MIER2
Conjugate Unconjugated
Supplier Page Shop

Product images