C20orf111 Antibody

Name C20orf111 Antibody
Supplier Novus Biologicals
Catalog NBP1-56864
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C20ORF111 The peptide sequence was selected from the N terminal of C20ORF111. Peptide sequence RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OSER1
Conjugate Unconjugated
Supplier Page Shop

Product images