RWDD1 Antibody

Name RWDD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56862
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RWDD1(RWD domain containing 1) The peptide sequence was selected from the middle region of RWDD1. Peptide sequence KKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RWDD1
Conjugate Unconjugated
Supplier Page Shop

Product images