MED31 Antibody
| Name | MED31 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56861 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine, Dog |
| Antigen | Synthetic peptides corresponding to MED31(mediator complex subunit 31) The peptide sequence was selected from the N terminal of MED31. Peptide sequence MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MED31 |
| Supplier Page | Shop |
Product images
![Western Blot: MED31 Antibody [NBP1-56861] - Human Liver cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/7793_MED31-Antibody-Western-Blot-NBP1-56861-img0002.jpg)
Western Blot: MED31 Antibody [NBP1-56861] - Human Liver cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: MED31 Antibody [NBP1-56861] - Quiescent human colon carcinoma cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/7794_MED31%2520Antibody-Western%2520Blot-NBP1-56861-img0003.jpg)
Western Blot: MED31 Antibody [NBP1-56861] - Quiescent human colon carcinoma cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.