CUTC Antibody

Name CUTC Antibody
Supplier Novus Biologicals
Catalog NBP1-56858
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CUTC(cutC copper transporter homolog (E. coli)) The peptide sequence was selected from the middle region of CUTC. Peptide sequence LEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARST.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CUTC
Conjugate Unconjugated
Supplier Page Shop

Product images