MFAP1 Antibody
| Name | MFAP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56849 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MFAP1(microfibrillar-associated protein 1) The peptide sequence was selected from the middle region of MFAP1. Peptide sequence TKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKT. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MFAP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: MFAP1 Antibody [NBP1-56849] - Human Brain lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7192_MFAP1-Antibody-Western-Blot-NBP1-56849-img0002.jpg)
![Western Blot: MFAP1 Antibody [NBP1-56849] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml MFAP1 is supported by BioGPS gene expression data to be expressed in 721_B.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7193_MFAP1%2520Antibody-Western%2520Blot-NBP1-56849-img0003.jpg)