ASPDH Antibody

Name ASPDH Antibody
Supplier Novus Biologicals
Catalog NBP1-56825
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LOC554235(hypothetical protein LOC554235) The peptide sequence was selected from the middle region of LOC554235. Peptide sequence LRSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPVRGLCPFAPRNSN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ASPDH
Conjugate Unconjugated
Supplier Page Shop

Product images