VPS54 Antibody

Name VPS54 Antibody
Supplier Novus Biologicals
Catalog NBP1-56818
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Rabbit
Antigen Synthetic peptides corresponding to VPS54(vacuolar protein sorting 54 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS54. Peptide sequence FNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVNIAHQISLRS.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene VPS54
Supplier Page Shop

Product images