HDDC3 Antibody

Name HDDC3 Antibody
Supplier Novus Biologicals
Catalog NBP1-56806
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HDDC3(HD domain containing 3) The peptide sequence was selected from the middle region of HDDC3. Peptide sequence TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HDDC3
Conjugate Unconjugated
Supplier Page Shop

Product images