GANC Antibody

Name GANC Antibody
Supplier Novus Biologicals
Catalog NBP1-56805
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GANC(glucosidase, alpha; neutral C) The peptide sequence was selected from the middle region of GANC. Peptide sequence VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GANC
Conjugate Unconjugated
Supplier Page Shop

Product images