WDR53 Antibody

Name WDR53 Antibody
Supplier Novus Biologicals
Catalog NBP1-56804
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Rabbit
Antigen Synthetic peptides corresponding to WDR53(WD repeat domain 53) The peptide sequence was selected from the middle region of WDR53. Peptide sequence NLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCG.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene WDR53
Supplier Page Shop

Product images