HARBI1 Antibody

Name HARBI1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56801
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C11ORF77 The peptide sequence was selected from the middle region of C11ORF77. Peptide sequence GVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HARBI1
Conjugate Unconjugated
Supplier Page Shop

Product images