RFESD Antibody

Name RFESD Antibody
Supplier Novus Biologicals
Catalog NBP1-56910
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse
Antigen Synthetic peptides corresponding to RFESD(Rieske (Fe-S) domain containing) The peptide sequence was selected from the middle region of RFESD. Peptide sequence VVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene RFESD
Supplier Page Shop

Product images