Name | RFESD Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56910 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Horse |
Antigen | Synthetic peptides corresponding to RFESD(Rieske (Fe-S) domain containing) The peptide sequence was selected from the middle region of RFESD. Peptide sequence VVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | RFESD |
Supplier Page | Shop |