HYLS1 Antibody

Name HYLS1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56899
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HYLS1(hydrolethalus syndrome 1) The peptide sequence was selected from the middle region of HYLS1. Peptide sequence YFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HYLS1
Conjugate Unconjugated
Supplier Page Shop

Product images