TBC1D13 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-56897
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to TBC1D13(TBC1 domain family, member 13) The peptide sequence was selected from the middle region of TBC1D13. Peptide sequence FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: TBC1D13
• Conjugate: Unconjugated