SCRN2 Antibody

Name SCRN2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56896
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SCRN2(secernin 2) The peptide sequence was selected from the N terminal of SCRN2. Peptide sequence MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SCRN2
Conjugate Unconjugated
Supplier Page Shop

Product images