PDXP Antibody

Name PDXP Antibody
Supplier Novus Biologicals
Catalog NBP1-56888
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PDXP(pyridoxal (pyridoxine, vitamin B6) phosphatase) The peptide sequence was selected from the middle region of PDXP. Peptide sequence DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PDXP
Conjugate Unconjugated
Supplier Page Shop

Product images