ARHGAP15 Antibody
| Name | ARHGAP15 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56885 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ARHGAP15(Rho GTPase activating protein 15) The peptide sequence was selected from the middle region of ARHGAP15. Peptide sequence VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ARHGAP15 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ARHGAP15 Antibody [NBP1-56885] - 293T cells lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7197_ARHGAP15-Antibody-Western-Blot-NBP1-56885-img0002.jpg)
![Western Blot: ARHGAP15 Antibody [NBP1-56885] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7198_ARHGAP15%2520Antibody-Western%2520Blot-NBP1-56885-img0003.jpg)