SPATA7 Antibody

Name SPATA7 Antibody
Supplier Novus Biologicals
Catalog NBP1-56884
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SPATA7(spermatogenesis associated 7) The peptide sequence was selected from the middle region of SPATA7. Peptide sequence FLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SPATA7
Conjugate Unconjugated
Supplier Page Shop

Product images