NUBP1 Antibody

Name NUBP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57039
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NUBP1 (nucleotide binding protein 1 (MinD homolog, E. coli)) The peptide sequence was selected from the N terminal of NUBP1. Peptide sequence MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NUBP1
Conjugate Unconjugated
Supplier Page Shop

Product images