ARHGEF19 Antibody

Name ARHGEF19 Antibody
Supplier Novus Biologicals
Catalog NBP1-57038
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ARHGEF19 (Rho guanine nucleotide exchange factor (GEF) 19) The peptide sequence was selected from the middle region of ARHGEF19 (NP_694945). Peptide sequence: RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ARHGEF19
Conjugate Unconjugated
Supplier Page Shop

Product images