Peflin Antibody

Name Peflin Antibody
Supplier Novus Biologicals
Catalog NBP1-56935
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PEF1(penta-EF-hand domain containing 1) The peptide sequence was selected from the middle region of PEF1. Peptide sequence WKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PEF1
Conjugate Unconjugated
Supplier Page Shop

Product images