AMN1 Antibody

Name AMN1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56931
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to AMN1(antagonist of mitotic exit network 1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of AMN1. Peptide sequence PRPRRVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGQIT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AMN1
Conjugate Unconjugated
Supplier Page Shop

Product images