RPIA Antibody

Name RPIA Antibody
Supplier Novus Biologicals
Catalog NBP1-56930
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RPIA(ribose 5-phosphate isomerase A (ribose 5-phosphate epimerase)) The peptide sequence was selected from the N terminal of RPIA. Peptide sequence MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RPIA
Conjugate Unconjugated
Supplier Page Shop

Product images