Name | RPIA Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56930 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to RPIA(ribose 5-phosphate isomerase A (ribose 5-phosphate epimerase)) The peptide sequence was selected from the N terminal of RPIA. Peptide sequence MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | RPIA |
Conjugate | Unconjugated |
Supplier Page | Shop |