TTC35 Antibody

Name TTC35 Antibody
Supplier Novus Biologicals
Catalog NBP1-56927
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TTC35(tetratricopeptide repeat domain 35) The peptide sequence was selected from the middle region of TTC35. Peptide sequence IQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene EMC2
Conjugate Unconjugated
Supplier Page Shop

Product images