Name | UTP14A Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56964 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Horse |
Antigen | Synthetic peptides corresponding to UTP14A (UTP14, U3 small nucleolar ribonucleoprotein, homolog A (yeast)) The peptide sequence was selected from the N terminal of UTP14A. Peptide sequence KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNL |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | UTP14A |
Supplier Page | Shop |