UTP14A Antibody

Name UTP14A Antibody
Supplier Novus Biologicals
Catalog NBP1-56964
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse
Antigen Synthetic peptides corresponding to UTP14A (UTP14, U3 small nucleolar ribonucleoprotein, homolog A (yeast)) The peptide sequence was selected from the N terminal of UTP14A. Peptide sequence KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNL
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene UTP14A
Supplier Page Shop

Product images