MRPS6 Antibody

Name MRPS6 Antibody
Supplier Novus Biologicals
Catalog NBP1-56962
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MRPS6 (mitochondrial ribosomal protein S6) The peptide sequence was selected from the middle region of MRPS6. Peptide sequence VESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MRPS6
Conjugate Unconjugated
Supplier Page Shop

Product images