GDAP2 Antibody

Name GDAP2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56959
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Rabbit
Antigen Synthetic peptides corresponding to GDAP2(ganglioside induced differentiation associated protein 2) The peptide sequence was selected from the N terminal of GDAP2. Peptide sequence SSLYSCYRNVLQLAKEQSMSSVGFCVINSAKRGYPLEDATHIALRTVRRF.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene GDAP2
Supplier Page Shop

Product images