Name | GDAP2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56959 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Horse, Rabbit |
Antigen | Synthetic peptides corresponding to GDAP2(ganglioside induced differentiation associated protein 2) The peptide sequence was selected from the N terminal of GDAP2. Peptide sequence SSLYSCYRNVLQLAKEQSMSSVGFCVINSAKRGYPLEDATHIALRTVRRF. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | GDAP2 |
Supplier Page | Shop |