RFTN2 Antibody

Name RFTN2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57042
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RFTN2 (raftlin family member 2) The peptide sequence was selected from the N terminal of RFTN2. Peptide sequence MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTLQASSN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RFTN2
Conjugate Unconjugated
Supplier Page Shop

Product images