Neuronatin Antibody

Name Neuronatin Antibody
Supplier Novus Biologicals
Catalog NBP1-57015
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NNAT (neuronatin) The peptide sequence was selected from the middle region of NNAT. Peptide sequence MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NNAT
Conjugate Unconjugated
Supplier Page Shop

Product images