C20orf30 Antibody

Name C20orf30 Antibody
Supplier Novus Biologicals
Catalog NBP1-59915
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C20ORF30 The peptide sequence was selected from the C terminal of C20ORF30. Peptide sequence KGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TMEM230
Conjugate Unconjugated
Supplier Page Shop

Product images