TTYH1 Antibody

Name TTYH1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59909
Prices $369.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TTYH1(tweety homolog 1 (Drosophila)) The peptide sequence was selected from the N terminal of TTYH1. Peptide sequence GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TTYH1
Conjugate Unconjugated
Supplier Page Shop

Product images