Name | TTYH1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59909 |
Prices | $369.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to TTYH1(tweety homolog 1 (Drosophila)) The peptide sequence was selected from the N terminal of TTYH1. Peptide sequence GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | TTYH1 |
Conjugate | Unconjugated |
Supplier Page | Shop |