MCTP1 Antibody

Name MCTP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59908
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Dog, Horse, Guinea Pig, Zebrafish
Antigen Synthetic peptides corresponding to MCTP1(multiple C2 domains, transmembrane 1) The peptide sequence was selected from the middle region of MCTP1. Peptide sequence EVTVYDEDRDRSADFLGKVAIPLLSIQNGEQKAYVLKNKQLTGPTKGVIY.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene MCTP1
Supplier Page Shop

Product images