SLC35F3 Antibody

Name SLC35F3 Antibody
Supplier Novus Biologicals
Catalog NBP1-59900
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to SLC35F3(solute carrier family 35, member F3) The peptide sequence was selected from the middle region of SLC35F3. Peptide sequence LKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSW.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SLC35F3
Supplier Page Shop

Product images