TMTC4 Antibody

Name TMTC4 Antibody
Supplier Novus Biologicals
Catalog NBP1-59824
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TMTC4(transmembrane and tetratricopeptide repeat containing 4) The peptide sequence was selected from the C terminal of TMTC4. Peptide sequence NDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRW.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TMTC4
Conjugate Unconjugated
Supplier Page Shop

Product images