ACBD5 Antibody

Name ACBD5 Antibody
Supplier Novus Biologicals
Catalog NBP1-59820
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ACBD5(acyl-Coenzyme A binding domain containing 5) The peptide sequence was selected from the N terminal of ACBD5. Peptide sequence ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ACBD5
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.