ORP8 Antibody
| Name | ORP8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59815 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to OSBPL8(oxysterol binding protein-like 8) The peptide sequence was selected from the middle region of OSBPL8. Peptide sequence YSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQTQEEIKR. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | OSBPL8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ORP8 Antibody [NBP1-59815] - HT1080, Antibody Dilution: 1.0 ug/ml OSBPL8 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24277_ORP8-Antibody-Western-Blot-NBP1-59815-img0003.jpg)
Western Blot: ORP8 Antibody [NBP1-59815] - HT1080, Antibody Dilution: 1.0 ug/ml OSBPL8 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells.
![Western Blot: ORP8 Antibody [NBP1-59815] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24278_ORP8-Antibody-Western-Blot-NBP1-59815-img0002.jpg)
Western Blot: ORP8 Antibody [NBP1-59815] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: ORP8 Antibody [NBP1-59815] - OVCAR-3, Antibody Dilution: 1.0 ug/ml OSBPL8 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24279_ORP8%2520Antibody-Western%2520Blot-NBP1-59815-img0004.jpg)
Western Blot: ORP8 Antibody [NBP1-59815] - OVCAR-3, Antibody Dilution: 1.0 ug/ml OSBPL8 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3.