ORP8 Antibody
| Name | ORP8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59814 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to OSBPL8(oxysterol binding protein-like 8) The peptide sequence was selected from the N terminal of OSBPL8. Peptide sequence SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | OSBPL8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ORP8 Antibody [NBP1-59814] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: 721_B cell lysate OSBPL8 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14430_ORP8%2520Antibody-Western%2520Blot-NBP1-59814-img0004.jpg)
Western Blot: ORP8 Antibody [NBP1-59814] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: 721_B cell lysate OSBPL8 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
![Immunohistochemistry: ORP8 Antibody [NBP1-59814] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm and plasma membrane in Kupffer cells and sinusoids Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14431_ORP8-Antibody-Immunohistochemistry-NBP1-59814-img0003.jpg)
Immunohistochemistry: ORP8 Antibody [NBP1-59814] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm and plasma membrane in Kupffer cells and sinusoids Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
![Western Blot: ORP8 Antibody [NBP1-59814] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14432_ORP8-Antibody-Western-Blot-NBP1-59814-img0002.jpg)
Western Blot: ORP8 Antibody [NBP1-59814] - 721_B cell lysate, concentration 0.2-1 ug/ml.