ABCD4 Antibody

Name ABCD4 Antibody
Supplier Novus Biologicals
Catalog NBP1-59807
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ABCD4(ATP-binding cassette, sub-family D (ALD), member 4) The peptide sequence was selected from the C terminal of ABCD4. Peptide sequence FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene ABCD4
Conjugate Unconjugated
Supplier Page Shop

Product images