PPAPDC1B/DPPL1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59800
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to PPAPDC1B(phosphatidic acid phosphatase type 2 domain containing 1B) The peptide sequence was selected from the middle region of PPAPDC1B. Peptide sequence KLIVGRPRPDFFYRCFPDGLAHSDLMCTGDKDVVNEGRKSFPSGHSSF
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: PPAPDC1B
• Conjugate: Unconjugated