Lamin B Receptor Antibody

Name Lamin B Receptor Antibody
Supplier Novus Biologicals
Catalog NBP1-59845
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LBR (lamin B receptor) The peptide sequence was selected from the middle region of LBR)(50ug). Peptide sequence GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LBR
Conjugate Unconjugated
Supplier Page Shop

Product images